Products
-
-
REP08049
Recombinant RHCE Protein
-
Alias：RH; RHC; RHE; Rh4; RHNA; RHPI; RhVI; RH30A; RHIXB; RhVIII; CD240CE; SLC42A4; RhIVb(J); RHCe(152N); RhD antigen; Rh polypeptide rh polypeptide rhesus C/E antigens; Rh blood group protein; Rh blood group C antigen; Rh blood group D antigen; RhCE blood group antigen; blood group protein RHCE; Rh blood group CE antigen; RhCE blood group antigens; blood group RhCcEe antigen; Rh blood group CcEe antigen; Rh blood group CcEe antigens; Rh blood group antigen Evans; Rhesus blood group E antigen; blood group RhCE polypeptide; RHCE*CeCw blood group antigen; Rhesus blood group CE protein; Rhesus blood group antigen CE; blood group Rh(CE) polypeptide; Rhesus blood group CcEe antigen; Rhesus blood group Rhce antigen; Rhesus system C and E polypeptides; Rh blood group CcEe antigen cE_340T; rhesus blood group little e antigen; silenced Rh blood group CcEe antigen; Rh blood group CcEe antigens RHCE_916G; rhesus blood group antigen, RhC antigen; blood group Rh(CE) polypeptide 144G RHCE; blood group Rh(C
-
Specification：10ug, 100ug
-
Target Name：RHCE
-
Purity：> 95%
-
Gene ID：
-
Genus：Homo sapiens (Human)
-
Application：Positive Control; Immunogen
Download The Manual
-
Product Details
|
Protein Length
|
Partial
|
Source
|
E.coli
|
|
Mol. Weight
|
19.8 kDa
|
Expression Region
|
379-417aa
|
|
Target Protein Sequence
|
TSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF
|
Protein Tag
|
N-terminal 6xHis-KSI-tagged
|
|
Storage Buffer
|
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
|
MSDS
|
MSDS Datasheet
|
|
Identification
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel
|
Activity
|
Not Test
|
|
Form
|
Liquid or Lyophilized powder (stock format preferred; remark special requirements when ordering)
|
Reconstitution
|
Briefly centrifuge prior to opening. Reconstitute in sterile deionized water to 0.1–1.0 mg/mL. Add 5–50% glycerol (final conc., default 50%) and aliquot for long-term storage at -20℃/-80℃.
|
|
Storage Condition
|
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
|