Protein names

Tumor necrosis factor ligand superfamily member 6 (CD95 ligand) (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD antigen CD178) [Cleaved into: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble form (Receptor-binding FasL ectodomain) (Soluble Fas ligand) (sFasL); ADAM10-processed FasL form (APL); FasL intracellular domain (FasL ICD) (SPPL2A-processed FasL form) (SPA)]

Protein Length

278 AA

Source

HEK293T

Mol. Weight

31 KD

Expression Region

1-278 AA

Target Protein Sequence

MQQPVNYPCPQIYWVDSSATSPWAPPGSVFSCPSSGPRGPGQRRPPPPPPPPSPLPPPSQPPPLPPLSPLKKKDNIELWLPVIFFMVLVALVGMGLGMYQLFHLQKELAELREFTNHSLRVSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVINEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSSYLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL

Protein Tag

C‑terminal/His6

Storage Buffer

If the delivery form is liquid, the default storage buffer is PBS-based buffer, 50% glycerol.Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is PBS-based buffer, 6% Trehalose.

MSDS

MSDS Datasheet

Identification

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel

Activity

Not Test

Form

Liquid or Lyophilized powder (stock format preferred; remark special requirements when ordering)

Reconstitution

Briefly centrifuge prior to opening. Reconstitute in sterile deionized water to 0.1–1.0 mg/mL. Add 50% glycerol (final conc., default 50%) and aliquot for long-term storage at -20℃/-80℃.

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.