Protein names

Platelet basic protein (PBP) (C-X-C motif chemokine 7) (Leukocyte-derived growth factor) (LDGF) (Macrophage-derived growth factor) (MDGF) (Small-inducible cytokine B7) [Cleaved into: Connective tissue-activating peptide III (CTAP-III) (LA-PF4) (Low-affinity platelet factor IV); TC-2; Connective tissue-activating peptide III(1-81) (CTAP-III(1-81)); Beta-thromboglobulin (Beta-TG); Neutrophil-activating peptide 2(74) (NAP-2(74)); Neutrophil-activating peptide 2(73) (NAP-2(73)); Neutrophil-activating peptide 2 (NAP-2); TC-1; Neutrophil-activating peptide 2(1-66) (NAP-2(1-66)); Neutrophil-activating peptide 2(1-63) (NAP-2(1-63))]

Protein Length

128 AA

Source

HEK293T

Mol. Weight

14 KD

Expression Region

1-128 AA

Target Protein Sequence

MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Protein Tag

C‑terminal/His6

Storage Buffer

If the delivery form is liquid, the default storage buffer is PBS-based buffer, 50% glycerol.Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is PBS-based buffer, 6% Trehalose.

MSDS

MSDS Datasheet

Identification

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel

Activity

Not Test

Form

Liquid or Lyophilized powder (stock format preferred; remark special requirements when ordering)

Reconstitution

Briefly centrifuge prior to opening. Reconstitute in sterile deionized water to 0.1–1.0 mg/mL. Add 50% glycerol (final conc., default 50%) and aliquot for long-term storage at -20℃/-80℃.

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.